General Information

  • ID:  hor000148
  • Uniprot ID:  Q9GT02(45-64)
  • Protein name:  CHH precursor-related peptide
  • Gene name:  NA
  • Organism:  Carcinus maenas (Common shore crab) (Green crab)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  animal
  • Expression:  sinus gland
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Carcinus (genus), Carcinidae (family), Portunoidea (superfamily), Heterotremata, Eubrachyura, Brachyura (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SPMEPSAALAVEHGTTHPLE
  • Length:  20(45-64)
  • Propeptide:  MYSKTIPAMLAIITVAYLCPLPHAHARSTPGYGRMDRILAALKTSPMEPSAALAVEHGTTHPLEKKQIYDTSCKGVYDRALFNDLEHVCDDCYNLYRTSYVASACRNNCFENEVFDVCVYELYFP
  • Signal peptide:  MYSKTIPAMLAIITVAYLCPLPHAHA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9GT02-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000148_AF2.pdbhor000148_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 241337 Formula: C89H140N24O31S
Absent amino acids: CDFIKNQRWY Common amino acids: AEP
pI: 4.47 Basic residues: 2
Polar residues: 5 Hydrophobic residues: 6
Hydrophobicity: -30 Boman Index: -1909
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 68.5
Instability Index: 3232 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  19523386
  • Title:  Characterization of the Carcinus Maenas Neuropeptidome by Mass Spectrometry and Functional Genomics